foofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofooairporthospitalsindustrylogisticsretailArtboardempowermentinnovationbrochureproductpassionproductsrespectteamworkwhitepaperwiring-diagramsfacebookinstagramlinkedintwitteryoutubearrowarrow-redux-bigarrow-redux-toparrow-redux-toparrow-reduxarrowcountrydownloadeyefile2filtergridhamburgerlanguagelistnopdfphoneplusresetsearchsubscribevideoyes

Br3 Family

PROGRAMMABLE 3-RELAY LOGIC MODULES
br3-family

Description

BEA’s Br3 family of logic modules provides both simple and advanced logic controls.

Functions include:
timer
ratchet/latching
inhibitor
2-relay sequencer + inhibitor
2-relay sequencer + door position
deactivation timer
3-relay sequencer + “1-shot”
3-relay sequencer with “independent relay”
interlock timer
interlock ratchet/latching
2-way, 2-relay sequence
normally locked restroom
normally unlocked restroom
3-relay sequencer + “day/night (24hr) mode”.

Common uses for the Br3 family include automatic pedestrian doors, access control, industrial automation and single-occupancy restrooms.

Features

Customizable

Programmable logic functions provide versatility across various applications (12 in the Br3; 13 in the Br3-X)

Intuitive programming

Two-button programming combined with dual seven-segment display provides simple setup

Integrated relays

Two 3-AMP relays and one 1-AMP relay, all with built-in surge suppression, eliminates the need for external components when installing some electric locking devices

On-board power

WET output with AC / DC voltage for powering an electric locking device directly from the module

Table of specifications

Supply Voltage

12 – 24 VAC / VDC ±10%

 

Power Consumption

30 – 130 mA; DRY Output

 

Temperature Range
Br3
Br3-X

 
−15 °F – 150 °F
−15 °F – 150 °F*
*If powered by AC voltage and using WET output to convert to DC voltage and current draw of device is greater than 0.9 A, the upper temperature range is 130 °F.

 

Dimensions

5.2 in (W) × 1.0 in (H) × 2.2 in (D)

 

Relay Hold Time

Up to 60 seconds per relay

 

Delay Between Relays

Up to 60 seconds per relay with ¼, ½ and ¾ second options

 

Housing Material

ABS Plastic

 

Input Specifications
Inputs 1, 2, 3, 4
WET Input

 
DRY contact
5 – 24 VAC / VDC ±10%

 

Contact Rating
Relay 1 (DRY)
Relay 1 (WET)
Relay 2
Relay 3

 
3 A @ 24 VAC / 30 VDC
1 A
3A @ 24 VAC / 30 VDC
1 A @ 24 VAC / 30 VDC

 
Versions
  • br3
    10BR3

    12 function, programmable, 3-relay logic module

  • br3-x
    10BR3X

    13 function, programmable, 3-relay advanced logic module

  • lo_mc
    10LE21

    Low-energy lockout module

  • mc25
    10MC25

    Delay on make / delay on break time relay module

Downloads
See all our products