foofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofoofooairporthospitalsindustrylogisticsretailArtboardempowermentinnovationbrochureproductpassionproductsrespectteamworkwhitepaperwiring-diagramsfacebookinstagramlinkedintwitteryoutubearrowarrow-redux-bigarrow-redux-toparrow-redux-toparrow-reduxarrowcountrydownloadeyefile2filtergridhamburgerlanguagelistnopdfphoneplusresetsearchsubscribevideoyes
sas-access-control

Access Control

Security & Access Sensing Solutions

Access Control applications present unique challenges that often require sensor-based solutions to effectively manage pedestrian traffic. BEA’s access control line includes a variety of products that can be combined to create all-in-one packages designed to enhance employee safety and security. These packages can be used within office-type applications to control access and secure doors. Sensors, keypads, electric strikes, push buttons, maglocks, and power supplies can all be found in BEA’s access control portfolio.

access-control-presence

Precise Presence Detection for Enhanced Access Control

In Access Control applications, active infrared sensors focus directly on a door handle while ignoring cross traffic, ensuring detection for those intending to exit. Passive infrared sensors are also available and can be used in areas requiring larger detection zones. 

See all related products
access-control-keypad

Key Switches, Key Pads and Push Buttons for Access Control Applications

A variety of devices are available for enhanced Access Control in secure areas. Key switches, key pads and push buttons all can be used to enhance security on a door. They can also be incorporated into a building’s security system.

See all related products
request-exit_access-control-advanced-logic

Advanced Logic for Increased Functionality in Access Control Applications

Logic modules enhance functionality on doors using sensors, locking devices and other means of Access Control. These devices can be used to properly sequence the door and streamline entry or exit into a building/secured area.

See all related products
access-control-maglocks

Electric Strikes and Maglocks for Enhanced Access Control

Locking devices used on secure door applications include electric strikes and maglocks, both of which can be paired with logic modules and sequenced with request to exit devices. UL listed strikes and maglocks are available for applications governed by coding and building standards.

See all related products
need more information? Contact Us